Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144740.1 | 5prime_partial | 179 | 2-541(+) |
Amino Acid sequence : | |||
HEANSSAMANLRRTLPLLHKTLNLTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTG QEQPPEAVNNNPVFAAVRSKVAENLNHAAPETRANPGQPWVRGWDDKRGLESGPKYGNQ* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 20,356.611 | ||
Theoretical pI: | 9.102 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 54.854 | ||
aromaticity | 0.061 | ||
GRAVY | -0.737 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.291 | ||
sheet | 0.285 |