| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144740.1 | 5prime_partial | 179 | 2-541(+) |
Amino Acid sequence : | |||
| HEANSSAMANLRRTLPLLHKTLNLTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTG QEQPPEAVNNNPVFAAVRSKVAENLNHAAPETRANPGQPWVRGWDDKRGLESGPKYGNQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,356.611 | ||
| Theoretical pI: | 9.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 54.854 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.737 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.291 | ||
| sheet | 0.285 | ||