| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144742.1 | 5prime_partial | 121 | 3-368(+) |
Amino Acid sequence : | |||
| QLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSHSNNGIDEGNAQQSYQMDMNNISSTSTDAFAVPMFSTESSENFWTVEDFWTMQPLNG D* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 14,131.438 | ||
| Theoretical pI: | 4.916 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 36.472 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.976 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.273 | ||
| sheet | 0.215 | ||