Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144754.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
GIKSGAKKIRRTFVLSASNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRLSRACEEIGASIRRV SEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKIYETDFGFGRPDRVELVSMNHDGEVTLAGGKEEGAVQVTVSLNRDQMETY | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,830.496 | ||
Theoretical pI: | 5.554 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 43.452 | ||
aromaticity | 0.069 | ||
GRAVY | -0.452 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.241 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144754.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
GIKSGAKKIRRTFVLSASNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRLSRACEEIGASIRRV SEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKIYETDFGFGRPDRVELVSMNHDGEVTLAGGKEEGAVQVTVSLNRDQMETY | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,830.496 | ||
Theoretical pI: | 5.554 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 43.452 | ||
aromaticity | 0.069 | ||
GRAVY | -0.452 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.241 | ||
sheet | 0.227 |