Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144771.1 | internal | 164 | 1-492(+) |
Amino Acid sequence : | |||
NNDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYY KKMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEIVPQN | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,890.405 | ||
Theoretical pI: | 9.359 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
Instability index: | 36.079 | ||
aromaticity | 0.104 | ||
GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.207 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144771.1 | internal | 164 | 1-492(+) |
Amino Acid sequence : | |||
NNDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYY KKMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEIVPQN | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,890.405 | ||
Theoretical pI: | 9.359 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
Instability index: | 36.079 | ||
aromaticity | 0.104 | ||
GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.207 | ||
sheet | 0.226 |