| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144773.1 | complete | 115 | 439-92(-) |
Amino Acid sequence : | |||
| MRCWPLLGLLFLFLAGLVSGLLLFVALLVSSSLGLVGSALLLVQGFPLLAKNLADLAELDTGVVLADLFTLLVGEEHVCGKTTLGRVGVLLLLAAISLGLGRGLAGGLLLGHDVG* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,035.350 | ||
| Theoretical pI: | 9.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 46.822 | ||
| aromaticity | 0.075 | ||
| GRAVY | -1.547 | ||
Secondary Structure Fraction | |||
| Helix | 0.142 | ||
| turn | 0.198 | ||
| sheet | 0.349 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144773.1 | complete | 106 | 104-424(+) |
Amino Acid sequence : | |||
| MPKEKTTRKAAPKSKADGGKKKKDPNAPKRGLSAYMFFANEQREKVREDNPGIKFGEVGKVLGEKWKALNEKQRTPYEAKAAADKKRYEEEKAAYQAGEEEEEESE* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,035.350 | ||
| Theoretical pI: | 9.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 46.822 | ||
| aromaticity | 0.075 | ||
| GRAVY | -1.547 | ||
Secondary Structure Fraction | |||
| Helix | 0.142 | ||
| turn | 0.198 | ||
| sheet | 0.349 | ||