Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144773.1 | complete | 115 | 439-92(-) |
Amino Acid sequence : | |||
MRCWPLLGLLFLFLAGLVSGLLLFVALLVSSSLGLVGSALLLVQGFPLLAKNLADLAELDTGVVLADLFTLLVGEEHVCGKTTLGRVGVLLLLAAISLGLGRGLAGGLLLGHDVG* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,035.350 | ||
Theoretical pI: | 9.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 46.822 | ||
aromaticity | 0.075 | ||
GRAVY | -1.547 | ||
Secondary Structure Fraction | |||
Helix | 0.142 | ||
turn | 0.198 | ||
sheet | 0.349 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144773.1 | complete | 106 | 104-424(+) |
Amino Acid sequence : | |||
MPKEKTTRKAAPKSKADGGKKKKDPNAPKRGLSAYMFFANEQREKVREDNPGIKFGEVGKVLGEKWKALNEKQRTPYEAKAAADKKRYEEEKAAYQAGEEEEEESE* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,035.350 | ||
Theoretical pI: | 9.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 46.822 | ||
aromaticity | 0.075 | ||
GRAVY | -1.547 | ||
Secondary Structure Fraction | |||
Helix | 0.142 | ||
turn | 0.198 | ||
sheet | 0.349 |