Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144788.1 | 5prime_partial | 185 | 2-559(+) |
Amino Acid sequence : | |||
IPLRKRAKERRERKMSGPTKKVAEAVAKAVTKKAAIDWEGMARVIVSDESRKELATLRRAFDEVNQQLETKFSQEPETIDWEYYRKGIGSRLVDMYKDAYDKIEIPKFVDNVTPEYKPKF DALLVELKEAEQQSLKESERLEKEIAEAREMKEKISTMTADDYFAKHPELKKKFDDEMRNDNWGY* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 21,786.552 | ||
Theoretical pI: | 6.889 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 39.855 | ||
aromaticity | 0.086 | ||
GRAVY | -1.003 | ||
Secondary Structure Fraction | |||
Helix | 0.249 | ||
turn | 0.130 | ||
sheet | 0.319 |