Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144791.1 | internal | 164 | 492-1(-) |
Amino Acid sequence : | |||
KREQPQDDQRTVRINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSF QSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEGSNTR | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 16,905.787 | ||
Theoretical pI: | 5.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 52.788 | ||
aromaticity | 0.082 | ||
GRAVY | -0.790 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.231 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144791.1 | 5prime_partial | 147 | 2-445(+) |
Amino Acid sequence : | |||
RVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRAS MENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,905.787 | ||
Theoretical pI: | 5.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 52.788 | ||
aromaticity | 0.082 | ||
GRAVY | -0.790 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.231 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144791.1 | internal | 164 | 492-1(-) |
Amino Acid sequence : | |||
KREQPQDDQRTVRINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSF QSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEGSNTR | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 16,905.787 | ||
Theoretical pI: | 5.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 52.788 | ||
aromaticity | 0.082 | ||
GRAVY | -0.790 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.231 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144791.1 | 5prime_partial | 147 | 2-445(+) |
Amino Acid sequence : | |||
RVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRAS MENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,905.787 | ||
Theoretical pI: | 5.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 52.788 | ||
aromaticity | 0.082 | ||
GRAVY | -0.790 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.231 | ||
sheet | 0.231 |