Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144801.1 | 5prime_partial | 127 | 3-386(+) |
Amino Acid sequence : | |||
KSRERRRWRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQH SGPVRYR* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 11,229.625 | ||
Theoretical pI: | 8.548 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 26.248 | ||
aromaticity | 0.063 | ||
GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.297 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144801.1 | 5prime_partial | 111 | 597-262(-) |
Amino Acid sequence : | |||
TIIVSHIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,229.625 | ||
Theoretical pI: | 8.548 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 26.248 | ||
aromaticity | 0.063 | ||
GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.297 | ||
sheet | 0.225 |