| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144801.1 | 5prime_partial | 127 | 3-386(+) |
Amino Acid sequence : | |||
| KSRERRRWRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQH SGPVRYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 11,229.625 | ||
| Theoretical pI: | 8.548 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 26.248 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.297 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144801.1 | 5prime_partial | 111 | 597-262(-) |
Amino Acid sequence : | |||
| TIIVSHIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,229.625 | ||
| Theoretical pI: | 8.548 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 26.248 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.297 | ||
| sheet | 0.225 | ||