| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144806.1 | 5prime_partial | 140 | 3-425(+) |
Amino Acid sequence : | |||
| VVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPENGIMEELRKRAEADRNDKSVKDLVLLLYETALLTSGFSLDDPNTFAGRIHRMLKLGLGIDEDEAAAD DIEMPPLEETAEESKMEEVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,666.535 | ||
| Theoretical pI: | 4.434 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 49.331 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.464 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.207 | ||
| sheet | 0.364 | ||