Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144814.1 | internal | 151 | 2-454(+) |
Amino Acid sequence : | |||
PCVTYIGKGGSGNFVKMVHNGIEYGDMQLISEAYDVLKSVGKLSNAELHQVFTEWNKGELLSFLIEITADIFGVKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSIAAPTIAASLDS RFLSGLKEERVEASKVFKSAGVSDTLSSGSV | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,139.130 | ||
Theoretical pI: | 5.164 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 12.150 | ||
aromaticity | 0.079 | ||
GRAVY | -0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.252 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144814.1 | internal | 151 | 2-454(+) |
Amino Acid sequence : | |||
PCVTYIGKGGSGNFVKMVHNGIEYGDMQLISEAYDVLKSVGKLSNAELHQVFTEWNKGELLSFLIEITADIFGVKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSIAAPTIAASLDS RFLSGLKEERVEASKVFKSAGVSDTLSSGSV | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,139.130 | ||
Theoretical pI: | 5.164 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 12.150 | ||
aromaticity | 0.079 | ||
GRAVY | -0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.252 | ||
sheet | 0.245 |