| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144814.1 | internal | 151 | 2-454(+) |
Amino Acid sequence : | |||
| PCVTYIGKGGSGNFVKMVHNGIEYGDMQLISEAYDVLKSVGKLSNAELHQVFTEWNKGELLSFLIEITADIFGVKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSIAAPTIAASLDS RFLSGLKEERVEASKVFKSAGVSDTLSSGSV | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,139.130 | ||
| Theoretical pI: | 5.164 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 12.150 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.252 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144814.1 | internal | 151 | 2-454(+) |
Amino Acid sequence : | |||
| PCVTYIGKGGSGNFVKMVHNGIEYGDMQLISEAYDVLKSVGKLSNAELHQVFTEWNKGELLSFLIEITADIFGVKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSIAAPTIAASLDS RFLSGLKEERVEASKVFKSAGVSDTLSSGSV | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,139.130 | ||
| Theoretical pI: | 5.164 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 12.150 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.252 | ||
| sheet | 0.245 | ||