| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144820.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
| QLPEEMNIHGRNGNAANVFLRNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKLLELRKIRRDGMEEKVRREIKILGLFRHPHIVRLYEVIETPSYIYIVMEYINSGDLYDYIVEKGRLSD DEARRFFQQIISGLVCCHRNLVVHRDVKPENILLDSQLNIKIVDFGLSNITRDGHFLKTSCGSPNYAA | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 21,587.801 | ||
| Theoretical pI: | 9.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 50.115 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.226 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.213 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144820.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
| QLPEEMNIHGRNGNAANVFLRNYKLGKTLGIGSFGKVKIAEHILTGHKVAIKLLELRKIRRDGMEEKVRREIKILGLFRHPHIVRLYEVIETPSYIYIVMEYINSGDLYDYIVEKGRLSD DEARRFFQQIISGLVCCHRNLVVHRDVKPENILLDSQLNIKIVDFGLSNITRDGHFLKTSCGSPNYAA | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 21,587.801 | ||
| Theoretical pI: | 9.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 50.115 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.226 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.213 | ||
| sheet | 0.229 | ||