| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144823.1 | 3prime_partial | 127 | 2-382(+) |
Amino Acid sequence : | |||
| MLAAGLVAKKASELGLEVKPWIKTSLAPGSGVVTKYLLKSGLQKYLNHQGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGS VDIDFEK | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,318.106 | ||
| Theoretical pI: | 6.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 21.474 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.276 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144823.1 | 3prime_partial | 127 | 2-382(+) |
Amino Acid sequence : | |||
| MLAAGLVAKKASELGLEVKPWIKTSLAPGSGVVTKYLLKSGLQKYLNHQGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGS VDIDFEK | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,318.106 | ||
| Theoretical pI: | 6.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 21.474 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.276 | ||
| sheet | 0.291 | ||