| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144831.1 | 5prime_partial | 130 | 2-394(+) |
Amino Acid sequence : | |||
| HEVQSGQMGMYPSPMPSQLGGMNNQPMPGGQFAGMMPQEALHASQMMGYGYGQYPYGSPPDPSQRMYGLSMQDYSANYANTTPSYQHVPSSSYTQQSARPAKAEDKLFGDLVSMAKSKPS KSGVNKVGSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,995.541 | ||
| Theoretical pI: | 8.129 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 14900 | ||
| Instability index: | 63.228 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.762 | ||
Secondary Structure Fraction | |||
| Helix | 0.177 | ||
| turn | 0.400 | ||
| sheet | 0.231 | ||