Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144831.1 | 5prime_partial | 130 | 2-394(+) |
Amino Acid sequence : | |||
HEVQSGQMGMYPSPMPSQLGGMNNQPMPGGQFAGMMPQEALHASQMMGYGYGQYPYGSPPDPSQRMYGLSMQDYSANYANTTPSYQHVPSSSYTQQSARPAKAEDKLFGDLVSMAKSKPS KSGVNKVGSL* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,995.541 | ||
Theoretical pI: | 8.129 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 14900 | ||
Instability index: | 63.228 | ||
aromaticity | 0.092 | ||
GRAVY | -0.762 | ||
Secondary Structure Fraction | |||
Helix | 0.177 | ||
turn | 0.400 | ||
sheet | 0.231 |