| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144848.1 | 3prime_partial | 184 | 50-601(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHG | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,212.922 | ||
| Theoretical pI: | 7.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 27.854 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.261 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144848.1 | 3prime_partial | 184 | 50-601(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHG | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,212.922 | ||
| Theoretical pI: | 7.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 27.854 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.261 | ||
| sheet | 0.239 | ||