| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144854.1 | internal | 217 | 3-653(+) |
Amino Acid sequence : | |||
| GGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRSLLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRV HVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGC | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 23,322.631 | ||
| Theoretical pI: | 9.248 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 53.677 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.304 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144854.1 | internal | 217 | 3-653(+) |
Amino Acid sequence : | |||
| GGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRSLLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRV HVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGC | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 23,322.631 | ||
| Theoretical pI: | 9.248 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 53.677 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.304 | ||
| sheet | 0.281 | ||