Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144854.1 | internal | 217 | 3-653(+) |
Amino Acid sequence : | |||
GGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRSLLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRV HVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGC | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 23,322.631 | ||
Theoretical pI: | 9.248 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 53.677 | ||
aromaticity | 0.088 | ||
GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.304 | ||
sheet | 0.281 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144854.1 | internal | 217 | 3-653(+) |
Amino Acid sequence : | |||
GGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRSLLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRV HVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGC | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 23,322.631 | ||
Theoretical pI: | 9.248 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 53.677 | ||
aromaticity | 0.088 | ||
GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.304 | ||
sheet | 0.281 |