Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144856.1 | internal | 203 | 2-610(+) |
Amino Acid sequence : | |||
HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGN | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 21,932.130 | ||
Theoretical pI: | 4.398 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 37.168 | ||
aromaticity | 0.074 | ||
GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.315 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144856.1 | internal | 203 | 2-610(+) |
Amino Acid sequence : | |||
HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGN | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 21,932.130 | ||
Theoretical pI: | 4.398 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 37.168 | ||
aromaticity | 0.074 | ||
GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.315 | ||
sheet | 0.212 |