| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144858.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
| HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCEGSMIVEAYAARANVKVPYASKGSGGFKRGVLRFTAISEHTRVVF | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 13,915.344 | ||
| Theoretical pI: | 9.420 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 48.910 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.242 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144858.1 | 5prime_partial | 120 | 676-314(-) |
Amino Acid sequence : | |||
| EYHPRVLRYRSEPQHSALKPSRALRCVWNLHIRSRRISFDDHRPFARVGRISDRKGQRVDLAGNRADNLSEGALFAGNEFDGTPSFGDGEVRSVDVFDGLEGFDYPARKWRVIVFDVRWD * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,915.344 | ||
| Theoretical pI: | 9.420 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 48.910 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.242 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144858.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
| HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCEGSMIVEAYAARANVKVPYASKGSGGFKRGVLRFTAISEHTRVVF | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 13,915.344 | ||
| Theoretical pI: | 9.420 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 48.910 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.242 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144858.1 | 5prime_partial | 120 | 676-314(-) |
Amino Acid sequence : | |||
| EYHPRVLRYRSEPQHSALKPSRALRCVWNLHIRSRRISFDDHRPFARVGRISDRKGQRVDLAGNRADNLSEGALFAGNEFDGTPSFGDGEVRSVDVFDGLEGFDYPARKWRVIVFDVRWD * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,915.344 | ||
| Theoretical pI: | 9.420 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 48.910 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.242 | ||
| sheet | 0.183 | ||