Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144858.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCEGSMIVEAYAARANVKVPYASKGSGGFKRGVLRFTAISEHTRVVF | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 13,915.344 | ||
Theoretical pI: | 9.420 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 48.910 | ||
aromaticity | 0.117 | ||
GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.242 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144858.1 | 5prime_partial | 120 | 676-314(-) |
Amino Acid sequence : | |||
EYHPRVLRYRSEPQHSALKPSRALRCVWNLHIRSRRISFDDHRPFARVGRISDRKGQRVDLAGNRADNLSEGALFAGNEFDGTPSFGDGEVRSVDVFDGLEGFDYPARKWRVIVFDVRWD * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,915.344 | ||
Theoretical pI: | 9.420 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 48.910 | ||
aromaticity | 0.117 | ||
GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.242 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144858.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCEGSMIVEAYAARANVKVPYASKGSGGFKRGVLRFTAISEHTRVVF | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 13,915.344 | ||
Theoretical pI: | 9.420 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 48.910 | ||
aromaticity | 0.117 | ||
GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.242 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144858.1 | 5prime_partial | 120 | 676-314(-) |
Amino Acid sequence : | |||
EYHPRVLRYRSEPQHSALKPSRALRCVWNLHIRSRRISFDDHRPFARVGRISDRKGQRVDLAGNRADNLSEGALFAGNEFDGTPSFGDGEVRSVDVFDGLEGFDYPARKWRVIVFDVRWD * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,915.344 | ||
Theoretical pI: | 9.420 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 48.910 | ||
aromaticity | 0.117 | ||
GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.242 | ||
sheet | 0.183 |