| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144863.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
| KNAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATILRLWDDLGSAEDENQEGYDGSYVEYLMKENPRYSKESARDDVMKMISTSWEALNKECFSSNQFAPNLVAACLNSS QMIEVMYS | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,277.965 | ||
| Theoretical pI: | 4.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 52.908 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.273 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144863.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
| KNAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATILRLWDDLGSAEDENQEGYDGSYVEYLMKENPRYSKESARDDVMKMISTSWEALNKECFSSNQFAPNLVAACLNSS QMIEVMYS | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,277.965 | ||
| Theoretical pI: | 4.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 52.908 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.273 | ||
| sheet | 0.313 | ||