| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144864.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
| DNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRV TVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,108.287 | ||
| Theoretical pI: | 8.642 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 39.149 | ||
| aromaticity | 0.072 | ||
| GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.273 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144864.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
| DNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRV TVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,108.287 | ||
| Theoretical pI: | 8.642 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 39.149 | ||
| aromaticity | 0.072 | ||
| GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.273 | ||
| sheet | 0.223 | ||