Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144864.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
DNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRV TVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,108.287 | ||
Theoretical pI: | 8.642 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 39.149 | ||
aromaticity | 0.072 | ||
GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.273 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144864.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
DNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRV TVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,108.287 | ||
Theoretical pI: | 8.642 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 39.149 | ||
aromaticity | 0.072 | ||
GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.273 | ||
sheet | 0.223 |