Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144871.1 | 5prime_partial | 133 | 3-404(+) |
Amino Acid sequence : | |||
AARVMIPARGGCIIATSSAASAVAGIAAIGYACSKHAIVGLTKNAAFELGQFGIRVNCVSPGGIATPLAVATTGMTREKFETFIDSMTSLKGVIPKSDDVANAVLYLASDDSRYVSGHDL FVDGILSLGNPVR* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 13,588.503 | ||
Theoretical pI: | 7.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 19.443 | ||
aromaticity | 0.060 | ||
GRAVY | 0.445 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.263 | ||
sheet | 0.263 |