Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144872.1 | 5prime_partial | 130 | 2-394(+) |
Amino Acid sequence : | |||
AMTCGLPMFATAYGGPAEIIVDGVSGYHIDPYQGDKAAELLVDFFDKCKDDPTHWDKFSEQGLKRIEEKYTWKLYSERLMTLAGVYGFWKFVSKLDRRETRRYLEMFYALKYRNLANSVP LAVDGEDDAK* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,995.897 | ||
Theoretical pI: | 5.403 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
Instability index: | 32.582 | ||
aromaticity | 0.146 | ||
GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.169 | ||
sheet | 0.277 |