Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144882.1 | complete | 140 | 3-425(+) |
Amino Acid sequence : | |||
MYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVGGGLVYGTKEGKLRVLQFYG SQDASCKETNHFLEESMLES* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,570.651 | ||
Theoretical pI: | 5.314 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
Instability index: | 48.901 | ||
aromaticity | 0.086 | ||
GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.207 | ||
sheet | 0.300 |