| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144882.1 | complete | 140 | 3-425(+) |
Amino Acid sequence : | |||
| MYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVGGGLVYGTKEGKLRVLQFYG SQDASCKETNHFLEESMLES* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,570.651 | ||
| Theoretical pI: | 5.314 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 48.901 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.207 | ||
| sheet | 0.300 | ||