| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144884.1 | 5prime_partial | 157 | 3-476(+) |
Amino Acid sequence : | |||
| QTELITLDANYSELIIKYYLVLEHQLDMCFSIFFGSSSLRAPTILSTIVPSFTKIKVGIASTAQSAATSFNSSTSTLRKMTSVNFFASSAKIGAIMRHGGHQVAVKSTTTSFLDMLACSS CCFHSSVVWQAITAPSATAADAAISLSKISPFLSAVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 13,148.275 | ||
| Theoretical pI: | 5.151 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 27.561 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.109 | ||
| sheet | 0.319 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144884.1 | complete | 119 | 433-74(-) |
Amino Acid sequence : | |||
| MAASAAVAEGAVIACHTTEEWKQQLEQANISKKLVVVDFTATWCPPCRMIAPIFAELAKKFTDVIFLKVDVDELKDVAADWAVEAMPTFIFVKEGTIVDKIVGALKDELPKKIEKHMSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,148.275 | ||
| Theoretical pI: | 5.151 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 27.561 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.109 | ||
| sheet | 0.319 | ||