Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144884.1 | 5prime_partial | 157 | 3-476(+) |
Amino Acid sequence : | |||
QTELITLDANYSELIIKYYLVLEHQLDMCFSIFFGSSSLRAPTILSTIVPSFTKIKVGIASTAQSAATSFNSSTSTLRKMTSVNFFASSAKIGAIMRHGGHQVAVKSTTTSFLDMLACSS CCFHSSVVWQAITAPSATAADAAISLSKISPFLSAVK* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 13,148.275 | ||
Theoretical pI: | 5.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 27.561 | ||
aromaticity | 0.076 | ||
GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.109 | ||
sheet | 0.319 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144884.1 | complete | 119 | 433-74(-) |
Amino Acid sequence : | |||
MAASAAVAEGAVIACHTTEEWKQQLEQANISKKLVVVDFTATWCPPCRMIAPIFAELAKKFTDVIFLKVDVDELKDVAADWAVEAMPTFIFVKEGTIVDKIVGALKDELPKKIEKHMSN* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,148.275 | ||
Theoretical pI: | 5.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 27.561 | ||
aromaticity | 0.076 | ||
GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.109 | ||
sheet | 0.319 |