| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144904.1 | internal | 106 | 3-320(+) |
Amino Acid sequence : | |||
| SMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNL | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,062.342 | ||
| Theoretical pI: | 5.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 30.960 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.274 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144904.1 | internal | 106 | 3-320(+) |
Amino Acid sequence : | |||
| SMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNL | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,062.342 | ||
| Theoretical pI: | 5.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 30.960 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.274 | ||
| sheet | 0.283 | ||