| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144947.1 | internal | 207 | 623-3(-) |
Amino Acid sequence : | |||
| RWHVLYPLGSDQVLVVPPLSRQVHRKLWLPVVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDER VVVRIEHVAIPNVLILHRPTDPIEEGEVDREVRVLVEAEERVDVDHEGRLVGVEEPDHLDHEAADVSTKRARRWDRLVPNSCSPGDP | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 23,015.029 | ||
| Theoretical pI: | 5.950 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
| Instability index: | 35.197 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.280 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144947.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
| WIPRAAGIRHEPVPSAGAFRADISGLMVEMVRFLDANKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANL DYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLIDENMKSVMPGTFERHWGIFTYDGKPKFPMDLSGQGGHNKYLVGAKGIEYMPT | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 23,015.029 | ||
| Theoretical pI: | 5.950 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
| Instability index: | 35.197 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.280 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144947.1 | internal | 207 | 623-3(-) |
Amino Acid sequence : | |||
| RWHVLYPLGSDQVLVVPPLSRQVHRKLWLPVVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDER VVVRIEHVAIPNVLILHRPTDPIEEGEVDREVRVLVEAEERVDVDHEGRLVGVEEPDHLDHEAADVSTKRARRWDRLVPNSCSPGDP | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 23,015.029 | ||
| Theoretical pI: | 5.950 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
| Instability index: | 35.197 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.280 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144947.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
| WIPRAAGIRHEPVPSAGAFRADISGLMVEMVRFLDANKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANL DYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLIDENMKSVMPGTFERHWGIFTYDGKPKFPMDLSGQGGHNKYLVGAKGIEYMPT | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 23,015.029 | ||
| Theoretical pI: | 5.950 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
| Instability index: | 35.197 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.280 | ||
| sheet | 0.227 | ||