Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144963.1 | internal | 235 | 2-706(+) |
Amino Acid sequence : | |||
KDYFVDERKKLASTRAMDNAGLKCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPL LVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELSPPPGQSKIDTSEKGGQF | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 18,940.323 | ||
Theoretical pI: | 5.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 54.855 | ||
aromaticity | 0.060 | ||
GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.211 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144963.1 | 5prime_partial | 166 | 706-206(-) |
Amino Acid sequence : | |||
KLPPFLRSIDLRLTRRRRELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCH AKTESLFDDCLEVGEFLDVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,940.323 | ||
Theoretical pI: | 5.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 54.855 | ||
aromaticity | 0.060 | ||
GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.211 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144963.1 | internal | 235 | 2-706(+) |
Amino Acid sequence : | |||
KDYFVDERKKLASTRAMDNAGLKCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPL LVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELSPPPGQSKIDTSEKGGQF | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 18,940.323 | ||
Theoretical pI: | 5.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 54.855 | ||
aromaticity | 0.060 | ||
GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.211 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144963.1 | 5prime_partial | 166 | 706-206(-) |
Amino Acid sequence : | |||
KLPPFLRSIDLRLTRRRRELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCH AKTESLFDDCLEVGEFLDVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,940.323 | ||
Theoretical pI: | 5.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 54.855 | ||
aromaticity | 0.060 | ||
GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.211 | ||
sheet | 0.271 |