| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144965.1 | internal | 233 | 2-700(+) |
Amino Acid sequence : | |||
| ISLRLCCVFHFEAMAESDARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLK DATNKARSFSSEAQRAGLVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPTAAYWSDKYNKIVCSSAEKGYTVSAYLPLVPVERISKVF | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 25,953.590 | ||
| Theoretical pI: | 9.008 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27640 | ||
| Instability index: | 38.930 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.193 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144965.1 | internal | 233 | 2-700(+) |
Amino Acid sequence : | |||
| ISLRLCCVFHFEAMAESDARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLK DATNKARSFSSEAQRAGLVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPTAAYWSDKYNKIVCSSAEKGYTVSAYLPLVPVERISKVF | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 25,953.590 | ||
| Theoretical pI: | 9.008 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27640 | ||
| Instability index: | 38.930 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.193 | ||
| sheet | 0.270 | ||