| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144978.1 | complete | 178 | 553-17(-) |
Amino Acid sequence : | |||
| MSMALTSGFLTSSLATVTVSTPFSIVAFTRSSFAFSGSRNLRVNFPLLLSTRCHRDSSSSSSFSFLLSPLIWRTLPSSTSTFTSSFLIPGRSTLNTCALGVSFQSTRVLARAEVSPGKLR LGVEVDRKSWRNGQRSKGSHRSRDKGSRMLLGREPNPNPNPLGTIDIFSGNKRKRLKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,262.573 | ||
| Theoretical pI: | 6.010 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.515 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.629 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144978.1 | complete | 170 | 54-566(+) |
Amino Acid sequence : | |||
| MSIVPSGFGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERRKEKDEEEEESRWHRVERS SGKFTRRFRLPENAKLDRVKATMENGVLTVTVAKEEVKKPEVKAIDISGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,262.573 | ||
| Theoretical pI: | 6.010 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.515 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.629 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||