Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144986.1 | internal | 166 | 499-2(-) |
Amino Acid sequence : | |||
EAHHSQKREQPQDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTC ASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEG | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 16,388.210 | ||
Theoretical pI: | 5.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 53.122 | ||
aromaticity | 0.077 | ||
GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.238 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144986.1 | 5prime_partial | 143 | 3-434(+) |
Amino Acid sequence : | |||
PSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENG VLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,388.210 | ||
Theoretical pI: | 5.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 53.122 | ||
aromaticity | 0.077 | ||
GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.238 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144986.1 | internal | 166 | 499-2(-) |
Amino Acid sequence : | |||
EAHHSQKREQPQDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTC ASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEG | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 16,388.210 | ||
Theoretical pI: | 5.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 53.122 | ||
aromaticity | 0.077 | ||
GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.238 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144986.1 | 5prime_partial | 143 | 3-434(+) |
Amino Acid sequence : | |||
PSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENG VLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,388.210 | ||
Theoretical pI: | 5.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 53.122 | ||
aromaticity | 0.077 | ||
GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.238 | ||
sheet | 0.238 |