| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145000.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
| ARGGADSDDLVLNSEAHFTSFVEKFGKSYKDAEEHAYRLSVFRSNMWRAKRHQKLDPSAVHGVTQFSDLTPSEFKRTFLGLRGKKGFKKMVSSAKDAPVLPTNDLPEDFDWRDHGAVTAV KNQGSCGSCWSFSTSGALEGANFLSTGNLETLSEQQMVDCDHECDPDEADACDAGCNGGLMTTAFEYLLKSGGLEREKDYPYAGTDRGTCKFDK | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 11,651.838 | ||
| Theoretical pI: | 7.981 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 84.471 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.967 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.295 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145000.1 | 5prime_partial | 105 | 3-320(+) |
Amino Acid sequence : | |||
| TRRGRLRRSRPQLGGPLHELRGEVREELQGCGGARLPAFGLPIEHVEGEEAPEARPLRRPWRHPVLRPNSLGVQEDVSWPQGEEGVQKDGFFSEGRAGAADQRSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,651.838 | ||
| Theoretical pI: | 7.981 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 84.471 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.967 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.295 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145000.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
| ARGGADSDDLVLNSEAHFTSFVEKFGKSYKDAEEHAYRLSVFRSNMWRAKRHQKLDPSAVHGVTQFSDLTPSEFKRTFLGLRGKKGFKKMVSSAKDAPVLPTNDLPEDFDWRDHGAVTAV KNQGSCGSCWSFSTSGALEGANFLSTGNLETLSEQQMVDCDHECDPDEADACDAGCNGGLMTTAFEYLLKSGGLEREKDYPYAGTDRGTCKFDK | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 11,651.838 | ||
| Theoretical pI: | 7.981 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 84.471 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.967 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.295 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145000.1 | 5prime_partial | 105 | 3-320(+) |
Amino Acid sequence : | |||
| TRRGRLRRSRPQLGGPLHELRGEVREELQGCGGARLPAFGLPIEHVEGEEAPEARPLRRPWRHPVLRPNSLGVQEDVSWPQGEEGVQKDGFFSEGRAGAADQRSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,651.838 | ||
| Theoretical pI: | 7.981 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 84.471 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.967 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.295 | ||
| sheet | 0.295 | ||