Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145012.1 | internal | 186 | 2-559(+) |
Amino Acid sequence : | |||
GHTPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEA LNPRAVAVVVDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNLGHLNKPSIQALIHGLNRHYY | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,514.388 | ||
Theoretical pI: | 6.037 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 34.646 | ||
aromaticity | 0.070 | ||
GRAVY | -0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.253 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145012.1 | internal | 186 | 2-559(+) |
Amino Acid sequence : | |||
GHTPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEA LNPRAVAVVVDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNLGHLNKPSIQALIHGLNRHYY | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,514.388 | ||
Theoretical pI: | 6.037 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 34.646 | ||
aromaticity | 0.070 | ||
GRAVY | -0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.253 | ||
sheet | 0.242 |