| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145027.1 | 5prime_partial | 103 | 3-314(+) |
Amino Acid sequence : | |||
| VTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMDKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILILVLAFGVRHFTKVEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,378.756 | ||
| Theoretical pI: | 4.854 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 31.572 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.223 | ||
| sheet | 0.223 | ||