Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145027.1 | 5prime_partial | 103 | 3-314(+) |
Amino Acid sequence : | |||
VTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMDKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILILVLAFGVRHFTKVEE* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,378.756 | ||
Theoretical pI: | 4.854 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 31.572 | ||
aromaticity | 0.087 | ||
GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.223 | ||
sheet | 0.223 |