| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145032.1 | internal | 215 | 1-645(+) |
Amino Acid sequence : | |||
| ARAPVEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKSGEYTGFPTL GVEWQKMENPDLRKAMGMLPNQKGVRIRRIEPTAPEFQFLKSSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNAVLRVLRNSQILE | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 23,433.343 | ||
| Theoretical pI: | 5.265 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 40.953 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.279 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145032.1 | internal | 215 | 1-645(+) |
Amino Acid sequence : | |||
| ARAPVEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKSGEYTGFPTL GVEWQKMENPDLRKAMGMLPNQKGVRIRRIEPTAPEFQFLKSSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNAVLRVLRNSQILE | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 23,433.343 | ||
| Theoretical pI: | 5.265 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 40.953 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.279 | ||
| sheet | 0.214 | ||