| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145034.1 | internal | 153 | 1-459(+) |
Amino Acid sequence : | |||
| ARDEKEEDMNSDLCRLAKLDFNFVQSIYKRELKELSRWWSNLGLGQKLSFARDRLMENYLFVIGWAFEPKLSQSREAMTMVNCLVTTIDDIYDIYGSLDELELFTDAINRWDAEAIEQLP DYMKICFMALFNTTNLTAYRIMCSKGVNIISQL | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,938.413 | ||
| Theoretical pI: | 4.661 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
| Instability index: | 39.632 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.170 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145034.1 | internal | 153 | 1-459(+) |
Amino Acid sequence : | |||
| ARDEKEEDMNSDLCRLAKLDFNFVQSIYKRELKELSRWWSNLGLGQKLSFARDRLMENYLFVIGWAFEPKLSQSREAMTMVNCLVTTIDDIYDIYGSLDELELFTDAINRWDAEAIEQLP DYMKICFMALFNTTNLTAYRIMCSKGVNIISQL | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,938.413 | ||
| Theoretical pI: | 4.661 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
| Instability index: | 39.632 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.170 | ||
| sheet | 0.314 | ||