Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145036.1 | 5prime_partial | 200 | 1-603(+) |
Amino Acid sequence : | |||
ARGYIEMEHPPNAKRISISILVISLPFLYLSLLRVPPSNLLKDTTFWFLVSNSIIAVIVTTDPGILTTSSGRREPGSDLYDEYVEHCKSTRASEVYIDQESRRDRVLDRHVDVGPKELST NRDSNRTSKDGAXFDRSMSEVALENRGVARKLVRRSVTEKRICRVEESSNDQYWKMSNEELNKRVEEFIRKFNREIRLQA* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 11,196.508 | ||
Theoretical pI: | 10.936 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 92.780 | ||
aromaticity | 0.047 | ||
GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
Helix | 0.189 | ||
turn | 0.500 | ||
sheet | 0.123 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145036.1 | complete | 106 | 35-355(+) |
Amino Acid sequence : | |||
MLRESPYPSSSSPFPSSISPSSASLPRIYSKTRPSGSSCPIPSSPSSSQPTPAFSPPHRVDVNPVPTSTTSMSSIANRLGRAKSISIKSRDVIGSWTDMSMLGRKS* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,196.508 | ||
Theoretical pI: | 10.936 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 92.780 | ||
aromaticity | 0.047 | ||
GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
Helix | 0.189 | ||
turn | 0.500 | ||
sheet | 0.123 |