Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145045.1 | 5prime_partial | 125 | 2-379(+) |
Amino Acid sequence : | |||
DDVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMDKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILILVLAFGVRHF TKVEE* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,895.495 | ||
Theoretical pI: | 4.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 29.912 | ||
aromaticity | 0.088 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.216 | ||
sheet | 0.200 |