| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145061.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
| ISPINAVALTREREKDAKNIKRLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPKELTCAGGKSPIEVANYI QRVLGGTLGFECTNFTRKDKYALLAGTDGVVRN* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 12,717.812 | ||
| Theoretical pI: | 7.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 47.550 | ||
| aromaticity | 0.018 | ||
| GRAVY | -1.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.158 | ||
| turn | 0.246 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145061.1 | 5prime_partial | 114 | 2-346(+) |
Amino Acid sequence : | |||
| HLPDQRGGANPREREGCQEHQASSGRRGPGHMPRRHDLSRAVSAAVQRALRRAHRPDRSGRGQHETEHVLWDVDERVEAFGPLLCVHEPQADLRDHVPEPAAEGANVRGREVAN* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,717.812 | ||
| Theoretical pI: | 7.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 47.550 | ||
| aromaticity | 0.018 | ||
| GRAVY | -1.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.158 | ||
| turn | 0.246 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145061.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
| ISPINAVALTREREKDAKNIKRLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPKELTCAGGKSPIEVANYI QRVLGGTLGFECTNFTRKDKYALLAGTDGVVRN* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 12,717.812 | ||
| Theoretical pI: | 7.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 47.550 | ||
| aromaticity | 0.018 | ||
| GRAVY | -1.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.158 | ||
| turn | 0.246 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145061.1 | 5prime_partial | 114 | 2-346(+) |
Amino Acid sequence : | |||
| HLPDQRGGANPREREGCQEHQASSGRRGPGHMPRRHDLSRAVSAAVQRALRRAHRPDRSGRGQHETEHVLWDVDERVEAFGPLLCVHEPQADLRDHVPEPAAEGANVRGREVAN* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,717.812 | ||
| Theoretical pI: | 7.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 47.550 | ||
| aromaticity | 0.018 | ||
| GRAVY | -1.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.158 | ||
| turn | 0.246 | ||
| sheet | 0.281 | ||