Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145073.1 | 5prime_partial | 110 | 2-334(+) |
Amino Acid sequence : | |||
YSLELPFSVSLPISSPAAAMASSTLSRWLRPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVLKQNRAAGVLDNFAEGENYAEHRVRKFVRNRSSEIMPSVNKFFSDPK* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,170.863 | ||
Theoretical pI: | 9.647 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 60.256 | ||
aromaticity | 0.091 | ||
GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.291 | ||
sheet | 0.273 |