| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145078.1 | 5prime_partial | 169 | 3-512(+) |
Amino Acid sequence : | |||
| GPTKKVAEAVAKAVTKKAAIDCEGMARVIVSDESRKELATLRRAFDEVNQQLETKFSQEPETIDWEYYRKGIGSRLVDMYKDAYDKIEIPKFVDNVTPEYKPKFDALLVELKEAEQQSLK ESERLEKEIAEAREMKEKISTMTADDYFAKHPELKKKFDDEMRNDNWGY* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 19,667.030 | ||
| Theoretical pI: | 5.125 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 31.864 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.891 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.130 | ||
| sheet | 0.320 | ||