| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145094.1 | 5prime_partial | 134 | 2-406(+) |
Amino Acid sequence : | |||
| GLQEFGTSPISDMERLHRIFGMGHTPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMGGGMVS LTSRFWVLAFWCGY* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,791.976 | ||
| Theoretical pI: | 5.022 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 34.211 | ||
| aromaticity | 0.090 | ||
| GRAVY | 0.125 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.246 | ||
| sheet | 0.284 | ||