| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145099.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
| IWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIID VNVAPPDSGFTESDITCTAKELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLI | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,172.349 | ||
| Theoretical pI: | 4.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 33.019 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.312 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145099.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
| IWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIID VNVAPPDSGFTESDITCTAKELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLI | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,172.349 | ||
| Theoretical pI: | 4.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 33.019 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.312 | ||
| sheet | 0.204 | ||