Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145099.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
IWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIID VNVAPPDSGFTESDITCTAKELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLI | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,172.349 | ||
Theoretical pI: | 4.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 33.019 | ||
aromaticity | 0.081 | ||
GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.312 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145099.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
IWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIID VNVAPPDSGFTESDITCTAKELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLI | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,172.349 | ||
Theoretical pI: | 4.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 33.019 | ||
aromaticity | 0.081 | ||
GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.312 | ||
sheet | 0.204 |