| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145105.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
| HEWSDKALHISAINQTKWWFAKRFLHPDIVAEYDYIFLWDEDLGVEHFNPDRYLSIIRREGLEISQPGLDTSKSQLHYRITARRGKGDVHRRIYQFHGGKRCYENSTAPPCTGWVEMMAP VFSRAAWRCVWHMIQNDLIHAWGLDKKLGYCAQGDRSKTVGVVDSEYIVHKGLPTLGGVDESRGSSGSHTNKDRFA | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 22,602.229 | ||
| Theoretical pI: | 8.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55920 56170 | ||
| Instability index: | 37.119 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.219 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145105.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
| HEWSDKALHISAINQTKWWFAKRFLHPDIVAEYDYIFLWDEDLGVEHFNPDRYLSIIRREGLEISQPGLDTSKSQLHYRITARRGKGDVHRRIYQFHGGKRCYENSTAPPCTGWVEMMAP VFSRAAWRCVWHMIQNDLIHAWGLDKKLGYCAQGDRSKTVGVVDSEYIVHKGLPTLGGVDESRGSSGSHTNKDRFA | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 22,602.229 | ||
| Theoretical pI: | 8.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55920 56170 | ||
| Instability index: | 37.119 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.219 | ||
| sheet | 0.194 | ||