Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145110.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
LNLVFCYLNEEWSNMNQNGAPPDLPISESIWSNLPHNVEKRKLKVPQQKNEYDCGLFVLYFMERFIEEAPERLKKKDLDMFGSKWFDPEEASGLRKRIRGLLIKESPSSFSHDNIEQHIV LDTSNRS* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,913.740 | ||
Theoretical pI: | 5.644 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 63.615 | ||
aromaticity | 0.102 | ||
GRAVY | -0.704 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.276 | ||
sheet | 0.260 |