Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145114.1 | 5prime_partial | 184 | 3-557(+) |
Amino Acid sequence : | |||
PLRKRAKERRERKMSGPTKKVAEAVAKAVTKKAAIDWEGMARVIVSDESRKELATLRRAFDEVNQQLETKFSQEPETIDWEYYRKGIGSRLVDMYKDAYDKIEIPKFVDNVTPEYKPKFD ALLVELKEAEQQSLKESERLEKEIAEAREMKEKISTMTADDYFAKHPELKKKFDDEMRNDNWGY* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 21,673.394 | ||
Theoretical pI: | 7.192 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 40.173 | ||
aromaticity | 0.087 | ||
GRAVY | -1.033 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.130 | ||
sheet | 0.321 |