| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145116.1 | 5prime_partial | 159 | 1-480(+) |
Amino Acid sequence : | |||
| AKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRA EDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 12,572.970 | ||
| Theoretical pI: | 11.443 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 52.815 | ||
| aromaticity | 0.054 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.330 | ||
| sheet | 0.143 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145116.1 | 5prime_partial | 112 | 3-341(+) |
Amino Acid sequence : | |||
| KVRPGTHPRRQFNRPVPRHEARCSCHDPCSLPRLHHFHVQYCVGERRHNPSRVRLFEARGGGANQVRGIRARNTRNPCELRLPSAPFHSSDHGLLQQDRGGGGGGDGFRGKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,572.970 | ||
| Theoretical pI: | 11.443 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 52.815 | ||
| aromaticity | 0.054 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.330 | ||
| sheet | 0.143 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145116.1 | 5prime_partial | 159 | 1-480(+) |
Amino Acid sequence : | |||
| AKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRA EDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 12,572.970 | ||
| Theoretical pI: | 11.443 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 52.815 | ||
| aromaticity | 0.054 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.330 | ||
| sheet | 0.143 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145116.1 | 5prime_partial | 112 | 3-341(+) |
Amino Acid sequence : | |||
| KVRPGTHPRRQFNRPVPRHEARCSCHDPCSLPRLHHFHVQYCVGERRHNPSRVRLFEARGGGANQVRGIRARNTRNPCELRLPSAPFHSSDHGLLQQDRGGGGGGDGFRGKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,572.970 | ||
| Theoretical pI: | 11.443 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 52.815 | ||
| aromaticity | 0.054 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.330 | ||
| sheet | 0.143 | ||