| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145121.1 | internal | 159 | 1-477(+) |
Amino Acid sequence : | |||
| QKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKKEYELDDTQMGVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAA EAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVN | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 18,703.251 | ||
| Theoretical pI: | 5.222 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 36.916 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.514 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.208 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145121.1 | internal | 159 | 1-477(+) |
Amino Acid sequence : | |||
| QKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKKEYELDDTQMGVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAA EAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVN | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 18,703.251 | ||
| Theoretical pI: | 5.222 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 36.916 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.514 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.208 | ||
| sheet | 0.277 | ||