| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145130.1 | 5prime_partial | 158 | 515-39(-) |
Amino Acid sequence : | |||
| RHSDSEHSVLHRSLHLIQFRILRQPESPRKLSAAPLDPVPPGLLPLLLVLFLAPLAADLEDSPLLHLDLHLLLLDPREVDPEHVRPGRLLPVHTCVGQSGGLAGEVETRSGSRQEVVEER TAIEGVPQVERQGVKDVAWSRTQPEPEPTGDYRHFFWK* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 17,400.348 | ||
| Theoretical pI: | 5.318 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 56.064 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.592 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.253 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145130.1 | 3prime_partial | 154 | 54-515(+) |
Amino Acid sequence : | |||
| MSIVPSGFGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERSKEKDEEEGEESRWHRVER SSGKFTRRFRLPENAKLDQVKATMEDGVLTVTVA | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,400.348 | ||
| Theoretical pI: | 5.318 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 56.064 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.592 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.253 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145130.1 | 5prime_partial | 158 | 515-39(-) |
Amino Acid sequence : | |||
| RHSDSEHSVLHRSLHLIQFRILRQPESPRKLSAAPLDPVPPGLLPLLLVLFLAPLAADLEDSPLLHLDLHLLLLDPREVDPEHVRPGRLLPVHTCVGQSGGLAGEVETRSGSRQEVVEER TAIEGVPQVERQGVKDVAWSRTQPEPEPTGDYRHFFWK* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 17,400.348 | ||
| Theoretical pI: | 5.318 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 56.064 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.592 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.253 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145130.1 | 3prime_partial | 154 | 54-515(+) |
Amino Acid sequence : | |||
| MSIVPSGFGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERSKEKDEEEGEESRWHRVER SSGKFTRRFRLPENAKLDQVKATMEDGVLTVTVA | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,400.348 | ||
| Theoretical pI: | 5.318 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 56.064 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.592 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.253 | ||
| sheet | 0.253 | ||