| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145142.1 | internal | 165 | 3-497(+) |
Amino Acid sequence : | |||
| TREKQNPLLPRLFAAVDDIFCLFQGHIENVAVLKQQYGLNKTANEVIIVIEAYRTLRDRGPYPADQVVRDLNGKFAFILYDSSSKTTFIAADADGNTPFFWGTGPEGHLVLSDDVDIVKK GCGKSFASFPKGCFFTTSKGLQSFEHPLNVVIAIPRVDSQGQVCG | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,158.454 | ||
| Theoretical pI: | 6.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 28.085 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.236 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145142.1 | internal | 165 | 3-497(+) |
Amino Acid sequence : | |||
| TREKQNPLLPRLFAAVDDIFCLFQGHIENVAVLKQQYGLNKTANEVIIVIEAYRTLRDRGPYPADQVVRDLNGKFAFILYDSSSKTTFIAADADGNTPFFWGTGPEGHLVLSDDVDIVKK GCGKSFASFPKGCFFTTSKGLQSFEHPLNVVIAIPRVDSQGQVCG | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,158.454 | ||
| Theoretical pI: | 6.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 28.085 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.236 | ||
| sheet | 0.188 | ||