| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145163.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
| IVSPPRKLPCNFRPPVSPPRVEFHDQKLLLRRDVSPPNVRPQVVQPSQSAALSGALQACRFGKCVPNSFSMVGYVINENEIFLHSPWPLPHFCVFAAIYPPVHVAAFLHHGIRPAGWSLG KGKGVRGD | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 12,705.250 | ||
| Theoretical pI: | 8.927 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 56.523 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.273 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145163.1 | 3prime_partial | 110 | 55-384(+) |
Amino Acid sequence : | |||
| MVEEGSNMDRGINSGEDTEVRKGPWTMEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDN | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,705.250 | ||
| Theoretical pI: | 8.927 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 56.523 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.273 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145163.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
| IVSPPRKLPCNFRPPVSPPRVEFHDQKLLLRRDVSPPNVRPQVVQPSQSAALSGALQACRFGKCVPNSFSMVGYVINENEIFLHSPWPLPHFCVFAAIYPPVHVAAFLHHGIRPAGWSLG KGKGVRGD | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 12,705.250 | ||
| Theoretical pI: | 8.927 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 56.523 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.273 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145163.1 | 3prime_partial | 110 | 55-384(+) |
Amino Acid sequence : | |||
| MVEEGSNMDRGINSGEDTEVRKGPWTMEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDN | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,705.250 | ||
| Theoretical pI: | 8.927 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 56.523 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.273 | ||
| sheet | 0.264 | ||