Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145163.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
IVSPPRKLPCNFRPPVSPPRVEFHDQKLLLRRDVSPPNVRPQVVQPSQSAALSGALQACRFGKCVPNSFSMVGYVINENEIFLHSPWPLPHFCVFAAIYPPVHVAAFLHHGIRPAGWSLG KGKGVRGD | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 12,705.250 | ||
Theoretical pI: | 8.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 56.523 | ||
aromaticity | 0.064 | ||
GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.273 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145163.1 | 3prime_partial | 110 | 55-384(+) |
Amino Acid sequence : | |||
MVEEGSNMDRGINSGEDTEVRKGPWTMEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDN | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,705.250 | ||
Theoretical pI: | 8.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 56.523 | ||
aromaticity | 0.064 | ||
GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.273 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145163.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
IVSPPRKLPCNFRPPVSPPRVEFHDQKLLLRRDVSPPNVRPQVVQPSQSAALSGALQACRFGKCVPNSFSMVGYVINENEIFLHSPWPLPHFCVFAAIYPPVHVAAFLHHGIRPAGWSLG KGKGVRGD | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 12,705.250 | ||
Theoretical pI: | 8.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 56.523 | ||
aromaticity | 0.064 | ||
GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.273 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145163.1 | 3prime_partial | 110 | 55-384(+) |
Amino Acid sequence : | |||
MVEEGSNMDRGINSGEDTEVRKGPWTMEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDN | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,705.250 | ||
Theoretical pI: | 8.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 56.523 | ||
aromaticity | 0.064 | ||
GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.273 | ||
sheet | 0.264 |