| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145175.1 | 3prime_partial | 159 | 50-526(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITP | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 16,687.060 | ||
| Theoretical pI: | 6.892 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 29.967 | ||
| aromaticity | 0.044 | ||
| GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.264 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145175.1 | 3prime_partial | 159 | 50-526(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITP | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 16,687.060 | ||
| Theoretical pI: | 6.892 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 29.967 | ||
| aromaticity | 0.044 | ||
| GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.264 | ||
| sheet | 0.239 | ||